PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID gw1.10.00.387.1
Common NameOT_ostta10g02070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family MYB
Protein Properties Length: 102aa    MW: 12132.8 Da    PI: 10.7003
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gw1.10.00.387.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-18248148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+teEd++lv +v+++G ++W+ Iar +  gR +kqc++rw+++l
  gw1.10.00.387.1  2 KGQWSTEEDQKLVGLVEKYGVRRWSYIARALS-GRVGKQCRERWNNHL 48
                     799*****************************.*************97 PP

2Myb_DNA-binding635.8e-205496145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     rg WT +E+e++++a+ +lG++ W+ Ia++++ gRt++++k++w+
  gw1.10.00.387.1 54 RGTWTLDEEEKFIEAHLELGNK-WSYIAKRLP-GRTENSVKNHWN 96
                     89********************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.652152IPR017930Myb domain
SMARTSM007171.3E-12150IPR001005SANT/Myb domain
SuperFamilySSF466892.92E-31295IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27356IPR009057Homeodomain-like
CDDcd001672.80E-11548No hitNo description
PfamPF139216.1E-18564No hitNo description
PROSITE profilePS5129421.88853102IPR017930Myb domain
SMARTSM007172.4E-1453101IPR001005SANT/Myb domain
CDDcd001672.21E-95696No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2157101IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
LKGQWSTEED QKLVGLVEKY GVRRWSYIAR ALSGRVGKQC RERWNNHLAP DIKRGTWTLD  60
EEEKFIEAHL ELGNKWSYIA KRLPGRTENS VKNHWNATRR RK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-4311023104MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-42110257158MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-42110257158MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-4311023104C-Myb DNA-Binding Domain
1msf_C6e-4311023104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003081644.11e-66putative transcription factor (ISS)
SwissprotQ9S7L23e-48MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A090M5982e-70A0A090M598_
STRINGQ00ZW43e-66(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-49myb domain protein 98
Publications ? help Back to Top
  1. Derelle E, et al.
    Genome analysis of the smallest free-living eukaryote Ostreococcus tauri unveils many unique features.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(31): p. 11647-52
    [PMID:16868079]